PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009599527.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 257aa    MW: 30094.7 Da    PI: 8.9877
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009599527.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.45.9e-17855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eE  ll ++vk++G g+W+++a   g++R +k+c++rw +yl
   XP_009599527.1  8 KGPWTAEENRLLFEYVKLHGEGRWSSVATVAGLKRNAKSCRLRWVNYL 55
                     79********************************************97 PP

2Myb_DNA-binding50.74e-1661105147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g  T  E++l++++++++G++ W+tIa+ ++ gRt++++k++w+++
   XP_009599527.1  61 KGQITSHEEKLILELHARWGNR-WATIAKNLP-GRTDNEIKNYWRTH 105
                      577799****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.863359IPR017930Myb domain
SuperFamilySSF466895.14E-295102IPR009057Homeodomain-like
SMARTSM007173.6E-15757IPR001005SANT/Myb domain
PfamPF002491.5E-15855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-22962IPR009057Homeodomain-like
CDDcd001679.65E-111055No hitNo description
PROSITE profilePS5129418.94260110IPR017930Myb domain
SMARTSM007171.2E-1460108IPR001005SANT/Myb domain
PfamPF002494.0E-1462105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2363109IPR009057Homeodomain-like
CDDcd001672.37E-1065106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MTKEGWRKGP WTAEENRLLF EYVKLHGEGR WSSVATVAGL KRNAKSCRLR WVNYLRPDLK  60
KGQITSHEEK LILELHARWG NRWATIAKNL PGRTDNEIKN YWRTHFKKKT KTSNNKSEIS  120
KARLLKRQQL QEQQQQQCNT DNDTNKVVSY NNNNKNYYAS ILNKLGNRIV SLLNENVNKV  180
PTLPQGNQEM EISYPNTADQ EQDDDFFYSI LNDYTPVPVL ESSSNEDIIW DVLWNLDDFQ  240
CNFSTPTYDT NMAIPFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-26811027128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009599527.10.0PREDICTED: myb-related protein 340-like
TrEMBLA0A061EPG82e-90A0A061EPG8_THECC; Myb domain protein 79 isoform 1
STRINGSolyc09g090790.2.13e-86(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.13e-68myb domain protein 305